PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00945.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 852aa    MW: 95004.7 Da    PI: 7.0042
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00945.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B369.25.8e-22162263199
                              EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfv 80 
                              f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++  +W++++i+r++++r++l++GW+ Fv++++L +gD +
  Rsa1.0_00945.1_g00003.1 162 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHAIEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAF 246
                              99*****************************7333.34459********************************************* PP

                              EEEE-SSSEE..EEEEE-S CS
                       B3  81 vFkldgrsefelvvkvfrk 99 
                              +F   + +++el+v+v+r+
  Rsa1.0_00945.1_g00003.1 247 IFL--RGENGELRVGVRRA 263
                              ***..449999*****996 PP

2Auxin_resp120.81e-39288370183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              a+ha+st+++F+v+Y+Pr+s+seF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp+rW +SkWrsLk
  Rsa1.0_00945.1_g00003.1 288 AWHAISTGTMFTVYYKPRTSPSEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDSDPTRWAKSKWRSLK 370
                              89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.107.9E-40158277IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.66E-40158291IPR015300DNA-binding pseudobarrel domain
CDDcd100175.15E-20160262No hitNo description
PROSITE profilePS5086311.166162264IPR003340B3 DNA binding domain
PfamPF023627.4E-20162263IPR003340B3 DNA binding domain
SMARTSM010191.3E-21162264IPR003340B3 DNA binding domain
PfamPF065077.7E-37288370IPR010525Auxin response factor
PfamPF023094.3E-11716817IPR033389AUX/IAA domain
PROSITE profilePS5174524.874726819IPR000270PB1 domain
SuperFamilySSF542771.42E-11727803No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 852 aa     Download sequence    Send to blast
MTTSADVSMK GNRGGGGENF SSLGYSDSTV AGEAAMKTQS NRSMAAERVV DAEAALYREL  60
WHACAGPLVT VPRQDDRVFY FPQGHIEQVE ASTNQAAEQQ MPLYDLPSKI LCRVINVDLK  120
AEADTDEVYA QITLLPEPMQ DENAIEKVPP PPPPPRFQVH SFCKTLTASD TSTHGGFSVL  180
RRHADECLPP LDMSRQPPTQ ELVAKDLHAI EWRFRHIFRG QPRRHLLQSG WSVFVSSKRL  240
VAGDAFIFLR GENGELRVGV RRAMRQQGNV PSSVISSHSM HLGVLATAWH AISTGTMFTV  300
YYKPRTSPSE FIVPFDQYME SVKNNYSIGM RFKMRFEGEE APEQRFTGTI VGIEDSDPTR  360
WAKSKWRSLK VRWDETTSIP RPDRVSPWKI EPALSPPALS PVPMPRPKRP RSNIAPSTPD  420
SSMRIREGSS KANMDPLPAS GLSRVLQGQE YPTLRTKHVE SVECDAPENS IVWQSSNDDD  480
KVDVVSASRR YENWMSSTRH EQPAYTDLLS GFGANIEPPP PHGHQIPMYD RLSSSPSVAA  540
RKILSDQDGK FEYLANQWQM MHSGLSLKLH ESPKVPAASD TSFQGISNPY ALPRAVTTTE  600
NAAGNWPIRP RALNYFEEAV HAQAREHVTK RPAVVQEEAA KPRDGNCRLF GIPLVNNVNG  660
TDTATAQRNN LNDTTGLTQI ASPKVQDLSD QSKGSKSTND HREQGRPFPV SKPHPKDVQT  720
KTNSSRSCTK VHKQGIALGR SVDLSKFQNY EELVTELDRL FEFNGELMAP KKDWLIVYTD  780
DENDMMLVGD DPWQEFCCMV RKIFIYTKEE VRKMNPRTLS CRNEEDAVAG EGSDAKDAKS  840
ASNPSLSSAG NS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1795539218354Auxin response factor 1
4ldw_A1e-1795539218354Auxin response factor 1
4ldw_B1e-1795539218354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794600.0JN979460.1 Brassica rapa subsp. pekinensis auxin response factor 2-2 (ARF2-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151321.10.0PREDICTED: auxin response factor 2
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLH9B4C10.0H9B4C1_BRARP; Auxin response factor
STRINGBra010048.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53482647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2